Home>Buyer Service>Sea Freight
- Inquiries by Catalogs
- Agriculture
- Apparel
- Automobiles & Motorcycles
- Beauty & Personal Care
- Business Services
- Chemicals
- Construction & Real Estate
- Consumer Electronics
- Electrical Equipment & Supplies
- Electronic Components & Supplies
- Energy
- Environment
- Excess Inventory
- Fashion Accessories
- Food & Beverage
- Furniture
- Gifts & Crafts
- Hardware
- Health & Medical
- Home & Garden
- Home Appliances
- Lights & Lighting
- Luggage, Bags & Cases
- Machinery
- Measurement & Analysis Instruments
- Mechanical Parts & Fabrication Services
- Minerals & Metallurgy
- Office & School Supplies
- Packaging & Printing
- Rubber & Plastics
- Security & Protection
- Service Equipment
- Shoes & Accessories
- Sports & Entertainment
- Telecommunications
- Textiles & Leather Products
- Timepieces, Jewelry, Eyewear
- Tools
- Toys & Hobbies
- Transportation
211 inquiries about Sea Freight
Hi, can you forward to germany a package containing tea without customs check ? It weight 45 KG, if yes how much would cost ? Thank you Francesco +49 172 1560657 (Whatsapp and WeChat)
- Sea Freight
- by shipping company agent, from China to KUMPORT
- United States
- IP : 165.225.72.**
- 2021-01-29 19:54:39
RORO vessel from China to Douala
have ODC cargo from China for shipment to Douala in Central African Republic
- Sea Freight
- RORO VESSEL CHINA SHANGHAI-DOUALA
- India
- IP : 106.214.93.**
- 2021-01-08 20:00:01
Please send me detail product specification, thank you!
- Sea Freight
- RORO VESSEL CHINA SHANGHAI-DOUALA
- India
- IP : 106.214.93.**
- 2021-01-08 18:18:18
I want the door to door delivery from Foshan to Perth Australia via sea freight
I want the door to door delivery from Foshan to Perth Australia via sea freight
I want the door to door delivery from Foshan to Perth Australia via sea freight
I want the door to door delivery from Foshan to Perth Australia via sea freight
- Sea Freight
- door to door ocean cargo vessel transport China to Bordeaux----website ID : bonmeddora
- United States
- IP : 199.64.6.**
- 2020-11-13 18:10:01
Hello, i want to ship cargo from China to gaborone no more than 10kg how much will it cost and how long will it take?
- Sea Freight
- shipping agency lines to GABORONE and FRANCISTOWN in BOTSWANA from China Shenzhen Shanghai Hongkong
- Botswana
- IP : 41.223.72.**
- 2020-10-28 04:23:55
HiI need your service to help me ship 40'HQ containers from China to USA ,FOB.I will have 1-2 containers a month soon,so i will definitely need your help to arrange everything.I will do mostly patio fruniture and gym equipment ,bikes ,car toys,dining sets.Please send me your contact number ,skype or whatsapp,whatever u have so we can get in touch.ASAP PleaseThank youAleksa Lekic
- Sea Freight
- ocean cargo vessel transport China to Besancon -----website ID : bonmeddora
- United States
- IP : 24.148.94.**
- 2020-10-15 12:30:01
Good day, I would kindly want to find out how much is the shipping fee by air to Namibia?
From China
- Sea Freight
- Freight Forwarder/shipping Agent/cargo Service
- Namibia
- IP : 197.233.52.**
- 2020-08-31 18:10:01
Hello, I am contacting you regarding a delivery I would like to make for a sample from one of my new suppliers. I would like to know how much it would cost me to send from China to France with your service.Thank you in advance for your reply.
- Sea Freight
- door to door ocean cargo vessel transport China to Bordeaux----website ID : bonmeddora
- France
- IP : 77.150.240.**
- 2020-08-20 05:40:02
Please send me the updated price and MOQ?Hi my name is kris tjelta and I am looking for a shipping company that will make shipments to canada. I have 30 boxes approx 1.2 cbm total and 300kg. I need picked up at room 203, building 4, no. 788 hongpu road, jianggan district, Hangzhou 310019, China. shipping to 258015 112 street west foothills alberta Canada. please quote
Hi my name is kris tjelta and I am looking for a shipping company that will make shipments to canada. I have 30 boxes approx 1.2 cbm total and 300kg. I need picked up at room 203, building 4, no. 788 hongpu road, jianggan district, Hangzhou 310019, China. shipping to 258015 112 street west foothills alberta Canada. please quote
- Sea Freight
- door to door ocean cargo vessel transport China to Bordeaux----website ID : bonmeddora
- Canada
- IP : 69.168.167.**
- 2020-07-06 22:30:01
Hi my name is kris tjelta and I am looking for a shipping company that will make shipments to canada. I have 30 boxes approx 1.2 cbm total and 300kg. I need picked up at room 203, building 4, no. 788 hongpu road, jianggan district, Hangzhou 310019, China. shipping to 258015 112 street west foothills alberta Canada T1S0W2. please quote
- Sea Freight
- door to door ocean cargo vessel transport China to Bordeaux----website ID : bonmeddora
- Canada
- IP : 69.168.167.**
- 2020-07-06 22:25:27
Sharad Akhouri: whenever I try to create a new site for printup.com.au. It shows me an error msg - "nothing here"
Start location: Shenzhen, ChinaEnd location: Syd, AusSize: 105cm*40cm*50cmWeight: 12kgGive me min quote, can collect from port.
Start location: Shenzhen, ChinaEnd location: Syd, AusSize: 105cm*40cm*50cmWeight: 12kgGive me min quote, can collect from port.
- Sea Freight
- sea freight transportation logistics to Augusta service from China ---website: bonmedora
- Australia
- IP : 149.167.201.**
- 2020-06-10 19:40:01
We intend to purchase this product, would you please send me the quotation Please quote 5 Gm of 3,3′,5-Triiodo--thyronine sodium salt Cas # 55-06-1.minimum order quantity?
- Sea Freight
- Levothyroxine sodium;L-Thyroxine Sodium (Steroids)
- United States
- IP : 98.184.223.**
- 2020-05-20 12:37:11
How do i register with you ... So as to get my goods sent from China to Nigera
My name is Akinsanmi Olatunji Johnson .... Am from Nigeria ... Am a business man ... Please do i register with you so i will have my own personal address in China so my goods can deliver and they can all be shipped to Nigeria
- Sea Freight
- professional sea shipping china to usa/canada/colombia/mexico------website ID : bonmeddora
- IP : 105.112.32.**
- 2020-05-10 06:20:01
Dear I am contacting you from Italy in order to cooperate with you. We need a quotation from you to make an air delivery from Dongguann City to Palermo (Sicily) that includes the following items 1. Item 1 (industrial machinery) size: 125 x 65 x 120 cm / weight: 180 kg 2. Item 2 (industrial machinery) size: 70 x 45 x 105 cm / weight: 100 kg 3. Item 3 (industrial machinery) size: 125 x 60 x 135 cm / weight: 60 kg 4. Item 4 (industrial machinery) size: 125 x 60 x 105 cm / weight: 50 kg Please send us your best offer
- Sea Freight
- Shenzhen New Chain Logistics Co., Ltd.
- Italy
- IP : 95.226.205.**
- 2020-04-17 17:48:27
Hi
Hi
I am looking for a quotation to ship 120.000kg Hand Sintenzer from Guangzhou or Frankfurt, Germany
To*. Can you give ma per KG quotation
- Sea Freight
- China/Guangdong/Yiwu/Jiangmen/Zhongshan/Dongguan/Shenzhen/Foshan/Guangzhou to (FiJi) Suva/Lautoka Cargo Air/Sea Freight (LCL/FCL) consolidation/Container
- Germany
- IP : 93.203.41.**
- 2020-04-02 20:40:02
Hello. I am a research scientist based at King's College London. I would like to enquire about getting three custom peptides synthesised. Could you please let me know how much it would cost and how long manufacture would take if I ordered the following:3 x 19aa peptides (each unique sequence):CGSHMGVSTDRIAGRGRINCGKMDSRGEHRQDRRERPYCGKMDSRGEHRQDRRERLY- All peptides with a biotin and ss-linker N-terminal modification- each 95% purity- quotes for both 1 mg and 10 mg amounts of each peptidethank you for your help in advancekind regards,Anny
- Sea Freight
- custom peptide
- United Kingdom
- IP : 193.61.207.**
- 2020-02-07 23:10:39
Price? Dysport
Price? Dysport
Price? Dysport
Price? Dysport
That's the originals?
- Sea Freight
- Dysport 500IU
- Turkey
- IP : 88.229.110.**
- 2020-01-19 09:00:02
Hello i will like to send goods from china to gambia. goods value 30kg, 12kg, 18kg respectively. can i get a quotation in RMB. goods items scarves
- Sea Freight
- China/Guangzhou/Dongguan/Shenzhen/Foshan/Jiangmen/Zhongshan/Guangdong/Yiwu to (East Timor) Dili Cargo Air/Sea Freight (LCL/FCL) consolidation/Container
- Nigeria
- IP : 197.210.85.**
- 2019-11-20 17:20:02
Please send me more about the product price? Is this original dysport? If yes, is it Turkish package or Iranian or Chinese package?
- Sea Freight
- Dysport anti wrinkle
- IP : 94.203.66.**
- 2019-11-08 04:24:17
Good Afternoon My Name is Pam Brown and I am a Reliable Education Student recommended to use Lucky Lucky for my freight needs by the owners of Reliable Education in Australia. This is my first order going from China to the US (Amazon FBA). I would like to organise an inspection of my order at the factory in Shanghai (For this first order there are only 100 units and they are off the shelf products with the only adjustment them putting a sticker with my barcode over the one on the box) I also would like to book freight services from the factory to the FBA fulfillment Centre in the U.S. I will also need assistance with any paperwork that is required including safety certificates for the products I am going to be selling. I have checked myself but there is so much information I am a little confused and would appreciate any help you can offer kind Regards Pam.
- Sea Freight
- Luckylucky Int'l Logistics & Supply Chain Management Co., Ltd.(Shenzhen)
- Australia
- IP : 110.143.198.**
- 2019-11-06 12:34:54
I would send you order.Please send me e-mail address for our order. Hi, My name is Robert, I contact you from Romania, I would need to transport the goods from Guangzhou to Bulgaria or Romania, I would need your transport services, but most importantly tell me if you can pay for me customs duties and VAT, in my name, the goods must arrive in Romania or Bulgaria, where it is better to pay taxes, and what would be the costs for your services.
- Sea Freight
- Shenzhen Tenglong Logistics Co., Ltd.
- Romania
- IP : 82.77.180.**
- 2019-09-25 17:09:01
When will hoegh will be going to the caribbean.
- Sea Freight
- RORO VESSEL SHANGHAI-TEMA/ HOEGH SHIPING
- IP : 209.59.90.**
- 2019-09-16 21:41:25
Dear Concern, We are one of the leading international freight forwarding agency. We are specialized in handling SEA / AIR freight shipments and if you can send your prepaid shipments consigning our company address then we will share 50/50 profit on each AWB. Attached file is our company profile. Sincerely, RYAN Chief Marketing Officer NEC GROUP House # 52, Suite 2N, Road # 13/C, Block # E, Banani, Dhaka-1213, Bangladesh. TEL: +8802982066-7, 9820668 FAX: +88029820669, Mob: +8801713435436 WhatsApp: +8801674148401 Email: ryan@necbd.net www. necgroupbd.com AIN: 301180425
- Sea Freight
- Shenzhen Uni-Home International Logistics Co., Ltd.
- IP : 103.245.108.**
- 2019-09-11 13:41:06
FCL 40ft/HC Huangpu To Karachi-Pakistan, 5 Container every month.commodity: Spare PartsLCL shipments Shanghai to Karachi Pakistan. Volume 30CBM/month
FCL 40ft/HC Huangpu To Karachi-Pakistan, 5 Container every month.commodity: Spare PartsLCL shipments Shanghai to Karachi Pakistan. Volume 30CBM/month
please contact me at what's app number 92321891251
- Sea Freight
- China Shenzhen Sea/ Ocean/ Air/ Fcl/ Lcl/ Agent Service
- Pakistan
- IP : 59.103.41.**
- 2019-08-29 21:10:01